Anti MEGF8 pAb (ATL-HPA049248)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049248-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MEGF8
Alternative Gene Name: C19orf49, EGFL4, FLJ22365, SBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045039: 99%, ENSRNOG00000052687: 99%
Entrez Gene ID: 1954
Uniprot ID: Q7Z7M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS |
| Gene Sequence | PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS |
| Gene ID - Mouse | ENSMUSG00000045039 |
| Gene ID - Rat | ENSRNOG00000052687 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEGF8 pAb (ATL-HPA049248) | |
| Datasheet | Anti MEGF8 pAb (ATL-HPA049248) Datasheet (External Link) |
| Vendor Page | Anti MEGF8 pAb (ATL-HPA049248) at Atlas Antibodies |
| Documents & Links for Anti MEGF8 pAb (ATL-HPA049248) | |
| Datasheet | Anti MEGF8 pAb (ATL-HPA049248) Datasheet (External Link) |
| Vendor Page | Anti MEGF8 pAb (ATL-HPA049248) |