Anti MEGF8 pAb (ATL-HPA049248)

Atlas Antibodies

Catalog No.:
ATL-HPA049248-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: multiple EGF-like-domains 8
Gene Name: MEGF8
Alternative Gene Name: C19orf49, EGFL4, FLJ22365, SBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045039: 99%, ENSRNOG00000052687: 99%
Entrez Gene ID: 1954
Uniprot ID: Q7Z7M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS
Gene Sequence PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS
Gene ID - Mouse ENSMUSG00000045039
Gene ID - Rat ENSRNOG00000052687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEGF8 pAb (ATL-HPA049248)
Datasheet Anti MEGF8 pAb (ATL-HPA049248) Datasheet (External Link)
Vendor Page Anti MEGF8 pAb (ATL-HPA049248) at Atlas Antibodies

Documents & Links for Anti MEGF8 pAb (ATL-HPA049248)
Datasheet Anti MEGF8 pAb (ATL-HPA049248) Datasheet (External Link)
Vendor Page Anti MEGF8 pAb (ATL-HPA049248)