Anti MEGF6 pAb (ATL-HPA052129)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052129-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MEGF6
Alternative Gene Name: EGFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057751: 83%, ENSRNOG00000000156: 83%
Entrez Gene ID: 1953
Uniprot ID: O75095
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDC |
| Gene Sequence | LHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDC |
| Gene ID - Mouse | ENSMUSG00000057751 |
| Gene ID - Rat | ENSRNOG00000000156 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEGF6 pAb (ATL-HPA052129) | |
| Datasheet | Anti MEGF6 pAb (ATL-HPA052129) Datasheet (External Link) |
| Vendor Page | Anti MEGF6 pAb (ATL-HPA052129) at Atlas Antibodies |
| Documents & Links for Anti MEGF6 pAb (ATL-HPA052129) | |
| Datasheet | Anti MEGF6 pAb (ATL-HPA052129) Datasheet (External Link) |
| Vendor Page | Anti MEGF6 pAb (ATL-HPA052129) |