Anti MEGF6 pAb (ATL-HPA052129)

Atlas Antibodies

Catalog No.:
ATL-HPA052129-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: multiple EGF-like-domains 6
Gene Name: MEGF6
Alternative Gene Name: EGFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057751: 83%, ENSRNOG00000000156: 83%
Entrez Gene ID: 1953
Uniprot ID: O75095
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDC
Gene Sequence LHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDC
Gene ID - Mouse ENSMUSG00000057751
Gene ID - Rat ENSRNOG00000000156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEGF6 pAb (ATL-HPA052129)
Datasheet Anti MEGF6 pAb (ATL-HPA052129) Datasheet (External Link)
Vendor Page Anti MEGF6 pAb (ATL-HPA052129) at Atlas Antibodies

Documents & Links for Anti MEGF6 pAb (ATL-HPA052129)
Datasheet Anti MEGF6 pAb (ATL-HPA052129) Datasheet (External Link)
Vendor Page Anti MEGF6 pAb (ATL-HPA052129)