Anti MEFV pAb (ATL-HPA077497)

Atlas Antibodies

Catalog No.: ATL-HPA077497-25

Protein Description: MEFV, pyrin innate immunity regulator
Gene Name: MEFV
Alternative Gene Name: FMF, MEF, TRIM20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022534: 56%, ENSRNOG00000008134: 51%
Entrez Gene ID: 4210
Uniprot ID: O15553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE
• Gene Sequence: HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE
• Gene ID - Mouse: ENSMUSG00000022534
• Gene ID - Rat: ENSRNOG00000008134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.