Anti MEFV pAb (ATL-HPA077497)

Atlas Antibodies

Catalog No.:
ATL-HPA077497-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: MEFV, pyrin innate immunity regulator
Gene Name: MEFV
Alternative Gene Name: FMF, MEF, TRIM20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022534: 56%, ENSRNOG00000008134: 51%
Entrez Gene ID: 4210
Uniprot ID: O15553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE
Gene Sequence HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE
Gene ID - Mouse ENSMUSG00000022534
Gene ID - Rat ENSRNOG00000008134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEFV pAb (ATL-HPA077497)
Datasheet Anti MEFV pAb (ATL-HPA077497) Datasheet (External Link)
Vendor Page Anti MEFV pAb (ATL-HPA077497) at Atlas Antibodies

Documents & Links for Anti MEFV pAb (ATL-HPA077497)
Datasheet Anti MEFV pAb (ATL-HPA077497) Datasheet (External Link)
Vendor Page Anti MEFV pAb (ATL-HPA077497)