Anti MEFV pAb (ATL-HPA077497)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077497-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MEFV
Alternative Gene Name: FMF, MEF, TRIM20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022534: 56%, ENSRNOG00000008134: 51%
Entrez Gene ID: 4210
Uniprot ID: O15553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE |
| Gene Sequence | HAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHERKSPGSLSPQPLPQCKRHLKQVQLLFCE |
| Gene ID - Mouse | ENSMUSG00000022534 |
| Gene ID - Rat | ENSRNOG00000008134 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MEFV pAb (ATL-HPA077497) | |
| Datasheet | Anti MEFV pAb (ATL-HPA077497) Datasheet (External Link) |
| Vendor Page | Anti MEFV pAb (ATL-HPA077497) at Atlas Antibodies |
| Documents & Links for Anti MEFV pAb (ATL-HPA077497) | |
| Datasheet | Anti MEFV pAb (ATL-HPA077497) Datasheet (External Link) |
| Vendor Page | Anti MEFV pAb (ATL-HPA077497) |