Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005533-25

Protein Description: myocyte enhancer factor 2C
Gene Name: MEF2C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005583: 97%, ENSRNOG00000033134: 99%
Entrez Gene ID: 4208
Uniprot ID: Q06413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
• Gene Sequence: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
• Gene ID - Mouse: ENSMUSG00000005583
• Gene ID - Rat: ENSRNOG00000033134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MEF2C pAb (ATL-HPA005533 w/enhanced validation) – 8 Found

Mifflin, Joshua J; Dupuis, Loren E; Alcala, Nicolas E; Russell, Lea G; Kern, Christine B. Intercalated cushion cells within the cardiac outflow tract are derived from the myocardial troponin T type 2 (Tnnt2) Cre lineage. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2018;247(8):1005-1017. 

Guo, Dongsheng; Daman, Katelyn; Chen, Jennifer Jc; Shi, Meng-Jiao; Yan, Jing; Matijasevic, Zdenka; Rickard, Amanda M; Bennett, Monica H; Kiselyov, Alex; Zhou, Haowen; Bang, Anne G; Wagner, Kathryn R; Maehr, René; King, Oliver D; Hayward, Lawrence J; Emerson, Charles P Jr. iMyoblasts for ex vivo and in vivo investigations of human myogenesis and disease modeling. Elife. 2022;11( 35076017) 

Wirrig, Elaine E; Hinton, Robert B; Yutzey, Katherine E. Differential expression of cartilage and bone-related proteins in pediatric and adult diseased aortic valves. Journal Of Molecular And Cellular Cardiology. 2011;50(3):561-9. 

Yelamanchili, S V; Chaudhuri, A Datta; Chen, L-N; Xiong, Huangui; Fox, H S. MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease. Cell Death & Disease. 1(9):e77. 

Clark, Christopher D; Zhang, Boding; Lee, Benjamin; Evans, Samuel I; Lassar, Andrew B; Lee, Kyu-Ho. Evolutionary conservation of Nkx2.5 autoregulation in the second heart field. Developmental Biology. 2013;374(1):198-209. 

Lockhart, Marie M; Wirrig, Elaine E; Phelps, Aimee L; Ghatnekar, Angela V; Barth, Jeremy L; Norris, Russell A; Wessels, Andy. Mef2c regulates transcription of the extracellular matrix protein cartilage link protein 1 in the developing murine heart. Plos One. 8(2):e57073. 

Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995. 

Clark, Christopher D; Lee, Kyu-Ho. Second heart field-specific expression of Nkx2-5 requires promoter proximal interaction with Srf. Mechanisms Of Development. 2020;162( 32450132):103615.