Anti MEF2A pAb (ATL-HPA046597)

Atlas Antibodies

Catalog No.:
ATL-HPA046597-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: myocyte enhancer factor 2A
Gene Name: MEF2A
Alternative Gene Name: RSRFC4, RSRFC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030557: 95%, ENSRNOG00000047756: 95%
Entrez Gene ID: 4205
Uniprot ID: Q02078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP
Gene Sequence DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP
Gene ID - Mouse ENSMUSG00000030557
Gene ID - Rat ENSRNOG00000047756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MEF2A pAb (ATL-HPA046597)
Datasheet Anti MEF2A pAb (ATL-HPA046597) Datasheet (External Link)
Vendor Page Anti MEF2A pAb (ATL-HPA046597) at Atlas Antibodies

Documents & Links for Anti MEF2A pAb (ATL-HPA046597)
Datasheet Anti MEF2A pAb (ATL-HPA046597) Datasheet (External Link)
Vendor Page Anti MEF2A pAb (ATL-HPA046597)