Anti MEF2A pAb (ATL-HPA046597)

Atlas Antibodies

Catalog No.: ATL-HPA046597-25

Protein Description: myocyte enhancer factor 2A
Gene Name: MEF2A
Alternative Gene Name: RSRFC4, RSRFC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030557: 95%, ENSRNOG00000047756: 95%
Entrez Gene ID: 4205
Uniprot ID: Q02078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP
• Gene Sequence: DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP
• Gene ID - Mouse: ENSMUSG00000030557
• Gene ID - Rat: ENSRNOG00000047756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.