Anti MED9 pAb (ATL-HPA056415)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056415-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MED9
Alternative Gene Name: FLJ10193, MED25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061650: 64%, ENSRNOG00000053961: 58%
Entrez Gene ID: 55090
Uniprot ID: Q9NWA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP |
| Gene Sequence | MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP |
| Gene ID - Mouse | ENSMUSG00000061650 |
| Gene ID - Rat | ENSRNOG00000053961 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MED9 pAb (ATL-HPA056415) | |
| Datasheet | Anti MED9 pAb (ATL-HPA056415) Datasheet (External Link) |
| Vendor Page | Anti MED9 pAb (ATL-HPA056415) at Atlas Antibodies |
| Documents & Links for Anti MED9 pAb (ATL-HPA056415) | |
| Datasheet | Anti MED9 pAb (ATL-HPA056415) Datasheet (External Link) |
| Vendor Page | Anti MED9 pAb (ATL-HPA056415) |