Anti MED9 pAb (ATL-HPA056415)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056415-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MED9
Alternative Gene Name: FLJ10193, MED25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061650: 64%, ENSRNOG00000053961: 58%
Entrez Gene ID: 55090
Uniprot ID: Q9NWA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP |
Gene Sequence | MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP |
Gene ID - Mouse | ENSMUSG00000061650 |
Gene ID - Rat | ENSRNOG00000053961 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED9 pAb (ATL-HPA056415) | |
Datasheet | Anti MED9 pAb (ATL-HPA056415) Datasheet (External Link) |
Vendor Page | Anti MED9 pAb (ATL-HPA056415) at Atlas Antibodies |
Documents & Links for Anti MED9 pAb (ATL-HPA056415) | |
Datasheet | Anti MED9 pAb (ATL-HPA056415) Datasheet (External Link) |
Vendor Page | Anti MED9 pAb (ATL-HPA056415) |