Anti MED9 pAb (ATL-HPA056415)

Atlas Antibodies

SKU: ATL-HPA056415-25

• 
• 

Protein Description: mediator complex subunit 9
Gene Name: MED9
Alternative Gene Name: FLJ10193, MED25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061650: 64%, ENSRNOG00000053961: 58%
Entrez Gene ID: 55090
Uniprot ID: Q9NWA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
• Gene Sequence: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
• Gene ID - Mouse: ENSMUSG00000061650
• Gene ID - Rat: ENSRNOG00000053961
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.