Anti MED7 pAb (ATL-HPA067181)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067181-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MED7
Alternative Gene Name: CRSP33, CRSP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020397: 100%, ENSRNOG00000007053: 100%
Entrez Gene ID: 9443
Uniprot ID: O43513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI |
| Gene Sequence | KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI |
| Gene ID - Mouse | ENSMUSG00000020397 |
| Gene ID - Rat | ENSRNOG00000007053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MED7 pAb (ATL-HPA067181) | |
| Datasheet | Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link) |
| Vendor Page | Anti MED7 pAb (ATL-HPA067181) at Atlas Antibodies |
| Documents & Links for Anti MED7 pAb (ATL-HPA067181) | |
| Datasheet | Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link) |
| Vendor Page | Anti MED7 pAb (ATL-HPA067181) |