Anti MED7 pAb (ATL-HPA067181)

Atlas Antibodies

SKU:
ATL-HPA067181-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 7
Gene Name: MED7
Alternative Gene Name: CRSP33, CRSP9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020397: 100%, ENSRNOG00000007053: 100%
Entrez Gene ID: 9443
Uniprot ID: O43513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI
Gene Sequence KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI
Gene ID - Mouse ENSMUSG00000020397
Gene ID - Rat ENSRNOG00000007053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MED7 pAb (ATL-HPA067181)
Datasheet Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link)
Vendor Page Anti MED7 pAb (ATL-HPA067181) at Atlas Antibodies

Documents & Links for Anti MED7 pAb (ATL-HPA067181)
Datasheet Anti MED7 pAb (ATL-HPA067181) Datasheet (External Link)
Vendor Page Anti MED7 pAb (ATL-HPA067181)