Anti MED6 pAb (ATL-HPA069039)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069039-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MED6
Alternative Gene Name: NY-REN-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002679: 100%, ENSRNOG00000006976: 100%
Entrez Gene ID: 10001
Uniprot ID: O75586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ |
Gene Sequence | LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ |
Gene ID - Mouse | ENSMUSG00000002679 |
Gene ID - Rat | ENSRNOG00000006976 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED6 pAb (ATL-HPA069039) | |
Datasheet | Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link) |
Vendor Page | Anti MED6 pAb (ATL-HPA069039) at Atlas Antibodies |
Documents & Links for Anti MED6 pAb (ATL-HPA069039) | |
Datasheet | Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link) |
Vendor Page | Anti MED6 pAb (ATL-HPA069039) |