Anti MED6 pAb (ATL-HPA069039)

Atlas Antibodies

Catalog No.: ATL-HPA069039-25

Protein Description: mediator complex subunit 6
Gene Name: MED6
Alternative Gene Name: NY-REN-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002679: 100%, ENSRNOG00000006976: 100%
Entrez Gene ID: 10001
Uniprot ID: O75586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
• Gene Sequence: LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
• Gene ID - Mouse: ENSMUSG00000002679
• Gene ID - Rat: ENSRNOG00000006976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.