Anti MED6 pAb (ATL-HPA069039)

Atlas Antibodies

Catalog No.:
ATL-HPA069039-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 6
Gene Name: MED6
Alternative Gene Name: NY-REN-28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002679: 100%, ENSRNOG00000006976: 100%
Entrez Gene ID: 10001
Uniprot ID: O75586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
Gene Sequence LGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQ
Gene ID - Mouse ENSMUSG00000002679
Gene ID - Rat ENSRNOG00000006976
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED6 pAb (ATL-HPA069039)
Datasheet Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link)
Vendor Page Anti MED6 pAb (ATL-HPA069039) at Atlas Antibodies

Documents & Links for Anti MED6 pAb (ATL-HPA069039)
Datasheet Anti MED6 pAb (ATL-HPA069039) Datasheet (External Link)
Vendor Page Anti MED6 pAb (ATL-HPA069039)