Anti MED29 pAb (ATL-HPA055956)

Atlas Antibodies

Catalog No.:
ATL-HPA055956-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 29
Gene Name: MED29
Alternative Gene Name: DKFZp434H247, IXL, MED2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003444: 99%, ENSRNOG00000019702: 99%
Entrez Gene ID: 55588
Uniprot ID: Q9NX70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN
Gene Sequence LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN
Gene ID - Mouse ENSMUSG00000003444
Gene ID - Rat ENSRNOG00000019702
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED29 pAb (ATL-HPA055956)
Datasheet Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link)
Vendor Page Anti MED29 pAb (ATL-HPA055956) at Atlas Antibodies

Documents & Links for Anti MED29 pAb (ATL-HPA055956)
Datasheet Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link)
Vendor Page Anti MED29 pAb (ATL-HPA055956)