Anti MED29 pAb (ATL-HPA055956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055956-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MED29
Alternative Gene Name: DKFZp434H247, IXL, MED2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003444: 99%, ENSRNOG00000019702: 99%
Entrez Gene ID: 55588
Uniprot ID: Q9NX70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN |
Gene Sequence | LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN |
Gene ID - Mouse | ENSMUSG00000003444 |
Gene ID - Rat | ENSRNOG00000019702 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED29 pAb (ATL-HPA055956) | |
Datasheet | Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link) |
Vendor Page | Anti MED29 pAb (ATL-HPA055956) at Atlas Antibodies |
Documents & Links for Anti MED29 pAb (ATL-HPA055956) | |
Datasheet | Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link) |
Vendor Page | Anti MED29 pAb (ATL-HPA055956) |