Anti MED29 pAb (ATL-HPA055956)

Atlas Antibodies

Catalog No.: ATL-HPA055956-25

Protein Description: mediator complex subunit 29
Gene Name: MED29
Alternative Gene Name: DKFZp434H247, IXL, MED2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003444: 99%, ENSRNOG00000019702: 99%
Entrez Gene ID: 55588
Uniprot ID: Q9NX70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN
• Gene Sequence: LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN
• Gene ID - Mouse: ENSMUSG00000003444
• Gene ID - Rat: ENSRNOG00000019702
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.