Anti MED29 pAb (ATL-HPA055956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055956-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MED29
Alternative Gene Name: DKFZp434H247, IXL, MED2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003444: 99%, ENSRNOG00000019702: 99%
Entrez Gene ID: 55588
Uniprot ID: Q9NX70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN |
| Gene Sequence | LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN |
| Gene ID - Mouse | ENSMUSG00000003444 |
| Gene ID - Rat | ENSRNOG00000019702 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MED29 pAb (ATL-HPA055956) | |
| Datasheet | Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link) |
| Vendor Page | Anti MED29 pAb (ATL-HPA055956) at Atlas Antibodies |
| Documents & Links for Anti MED29 pAb (ATL-HPA055956) | |
| Datasheet | Anti MED29 pAb (ATL-HPA055956) Datasheet (External Link) |
| Vendor Page | Anti MED29 pAb (ATL-HPA055956) |