Anti MED26 pAb (ATL-HPA071835)

Atlas Antibodies

Catalog No.: ATL-HPA071835-25

Protein Description: mediator complex subunit 26
Gene Name: MED26
Alternative Gene Name: CRSP7, CRSP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045248: 58%, ENSRNOG00000012270: 63%
Entrez Gene ID: 9441
Uniprot ID: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS
• Gene Sequence: ALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSS
• Gene ID - Mouse: ENSMUSG00000045248
• Gene ID - Rat: ENSRNOG00000012270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.