Anti MED26 pAb (ATL-HPA057997 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA057997-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 26
Gene Name: MED26
Alternative Gene Name: CRSP7, CRSP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045248: 88%, ENSRNOG00000012270: 88%
Entrez Gene ID: 9441
Uniprot ID: O95402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT
Gene Sequence PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT
Gene ID - Mouse ENSMUSG00000045248
Gene ID - Rat ENSRNOG00000012270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED26 pAb (ATL-HPA057997 w/enhanced validation)
Datasheet Anti MED26 pAb (ATL-HPA057997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MED26 pAb (ATL-HPA057997 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MED26 pAb (ATL-HPA057997 w/enhanced validation)
Datasheet Anti MED26 pAb (ATL-HPA057997 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MED26 pAb (ATL-HPA057997 w/enhanced validation)