Anti MED23 pAb (ATL-HPA070341)

Atlas Antibodies

SKU: ATL-HPA070341-25

• 

Protein Description: mediator complex subunit 23
Gene Name: MED23
Alternative Gene Name: CRSP130, CRSP3, DRIP130, Sur2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019984: 100%, ENSRNOG00000013422: 100%
Entrez Gene ID: 9439
Uniprot ID: Q9ULK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG
• Gene Sequence: PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG
• Gene ID - Mouse: ENSMUSG00000019984
• Gene ID - Rat: ENSRNOG00000013422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.