Anti MED19 pAb (ATL-HPA040860)

Atlas Antibodies

Catalog No.:
ATL-HPA040860-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 19
Gene Name: MED19
Alternative Gene Name: LCMR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027080: 96%, ENSRNOG00000006050: 96%
Entrez Gene ID: 219541
Uniprot ID: A0JLT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
Gene Sequence PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
Gene ID - Mouse ENSMUSG00000027080
Gene ID - Rat ENSRNOG00000006050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED19 pAb (ATL-HPA040860)
Datasheet Anti MED19 pAb (ATL-HPA040860) Datasheet (External Link)
Vendor Page Anti MED19 pAb (ATL-HPA040860) at Atlas Antibodies

Documents & Links for Anti MED19 pAb (ATL-HPA040860)
Datasheet Anti MED19 pAb (ATL-HPA040860) Datasheet (External Link)
Vendor Page Anti MED19 pAb (ATL-HPA040860)