Anti MED19 pAb (ATL-HPA039912)

Atlas Antibodies

Catalog No.: ATL-HPA039912-25

Protein Description: mediator complex subunit 19
Gene Name: MED19
Alternative Gene Name: LCMR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027080: 96%, ENSRNOG00000006050: 96%
Entrez Gene ID: 219541
Uniprot ID: A0JLT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV
• Gene Sequence: GSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPV
• Gene ID - Mouse: ENSMUSG00000027080
• Gene ID - Rat: ENSRNOG00000006050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MED19 pAb (ATL-HPA039912) – 1 Found

Yu, Shengqiang; Wang, Yanwei; Yuan, Hejia; Zhao, Hongwei; Lv, Wei; Chen, Jian; Wan, Fengchun; Liu, Dongfu; Gao, Zhenli; Wu, Jitao. Knockdown of Mediator Complex Subunit 19 Suppresses the Growth and Invasion of Prostate Cancer Cells. Plos One. 12(1):e0171134.