Anti MED15 pAb (ATL-HPA003179)

Atlas Antibodies

Catalog No.: ATL-HPA003179-25

Protein Description: mediator complex subunit 15
Gene Name: MED15
Alternative Gene Name: Arc105, CAG7A, PCQAP, TIG-1, TNRC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012114: 96%, ENSRNOG00000001877: 96%
Entrez Gene ID: 51586
Uniprot ID: Q96RN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
• Gene Sequence: QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
• Gene ID - Mouse: ENSMUSG00000012114
• Gene ID - Rat: ENSRNOG00000001877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MED15 pAb (ATL-HPA003179) – 1 Found

Thiaville, Michelle M; Dudenhausen, Elizabeth E; Awad, Keytam S; Gjymishka, Altin; Zhong, Can; Kilberg, Michael S. Activated transcription via mammalian amino acid response elements does not require enhanced recruitment of the Mediator complex. Nucleic Acids Research. 2008;36(17):5571-80.