Anti MED14 pAb (ATL-HPA064182)

Atlas Antibodies

SKU:
ATL-HPA064182-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 14
Gene Name: MED14
Alternative Gene Name: CRSP150, CRSP2, CSRP, CXorf4, EXLM1, RGR1, TRAP170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064127: 100%, ENSRNOG00000003792: 100%
Entrez Gene ID: 9282
Uniprot ID: O60244
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Gene Sequence PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP
Gene ID - Mouse ENSMUSG00000064127
Gene ID - Rat ENSRNOG00000003792
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MED14 pAb (ATL-HPA064182)
Datasheet Anti MED14 pAb (ATL-HPA064182) Datasheet (External Link)
Vendor Page Anti MED14 pAb (ATL-HPA064182) at Atlas Antibodies

Documents & Links for Anti MED14 pAb (ATL-HPA064182)
Datasheet Anti MED14 pAb (ATL-HPA064182) Datasheet (External Link)
Vendor Page Anti MED14 pAb (ATL-HPA064182)