Anti MED13 pAb (ATL-HPA067939)

Atlas Antibodies

Catalog No.:
ATL-HPA067939-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 13
Gene Name: MED13
Alternative Gene Name: KIAA0593, THRAP1, TRAP240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034297: 97%, ENSRNOG00000003679: 97%
Entrez Gene ID: 9969
Uniprot ID: Q9UHV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
Gene Sequence SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
Gene ID - Mouse ENSMUSG00000034297
Gene ID - Rat ENSRNOG00000003679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED13 pAb (ATL-HPA067939)
Datasheet Anti MED13 pAb (ATL-HPA067939) Datasheet (External Link)
Vendor Page Anti MED13 pAb (ATL-HPA067939) at Atlas Antibodies

Documents & Links for Anti MED13 pAb (ATL-HPA067939)
Datasheet Anti MED13 pAb (ATL-HPA067939) Datasheet (External Link)
Vendor Page Anti MED13 pAb (ATL-HPA067939)