Anti MED13 pAb (ATL-HPA067939)

Atlas Antibodies

Catalog No.: ATL-HPA067939-25

Protein Description: mediator complex subunit 13
Gene Name: MED13
Alternative Gene Name: KIAA0593, THRAP1, TRAP240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034297: 97%, ENSRNOG00000003679: 97%
Entrez Gene ID: 9969
Uniprot ID: Q9UHV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
• Gene Sequence: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
• Gene ID - Mouse: ENSMUSG00000034297
• Gene ID - Rat: ENSRNOG00000003679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.