Anti MED10 pAb (ATL-HPA054188)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054188-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MED10
Alternative Gene Name: L6, MGC5309, NUT2, TRG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021598: 98%, ENSRNOG00000017150: 98%
Entrez Gene ID: 84246
Uniprot ID: Q9BTT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP |
Gene Sequence | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP |
Gene ID - Mouse | ENSMUSG00000021598 |
Gene ID - Rat | ENSRNOG00000017150 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED10 pAb (ATL-HPA054188) | |
Datasheet | Anti MED10 pAb (ATL-HPA054188) Datasheet (External Link) |
Vendor Page | Anti MED10 pAb (ATL-HPA054188) at Atlas Antibodies |
Documents & Links for Anti MED10 pAb (ATL-HPA054188) | |
Datasheet | Anti MED10 pAb (ATL-HPA054188) Datasheet (External Link) |
Vendor Page | Anti MED10 pAb (ATL-HPA054188) |