Anti MED10 pAb (ATL-HPA054188)

Atlas Antibodies

Catalog No.:
ATL-HPA054188-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mediator complex subunit 10
Gene Name: MED10
Alternative Gene Name: L6, MGC5309, NUT2, TRG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021598: 98%, ENSRNOG00000017150: 98%
Entrez Gene ID: 84246
Uniprot ID: Q9BTT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
Gene Sequence MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP
Gene ID - Mouse ENSMUSG00000021598
Gene ID - Rat ENSRNOG00000017150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MED10 pAb (ATL-HPA054188)
Datasheet Anti MED10 pAb (ATL-HPA054188) Datasheet (External Link)
Vendor Page Anti MED10 pAb (ATL-HPA054188) at Atlas Antibodies

Documents & Links for Anti MED10 pAb (ATL-HPA054188)
Datasheet Anti MED10 pAb (ATL-HPA054188) Datasheet (External Link)
Vendor Page Anti MED10 pAb (ATL-HPA054188)