Anti MED1 pAb (ATL-HPA052818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052818-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MED1
Alternative Gene Name: CRSP1, CRSP200, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018160: 100%, ENSRNOG00000005606: 100%
Entrez Gene ID: 5469
Uniprot ID: Q15648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
Gene Sequence | MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
Gene ID - Mouse | ENSMUSG00000018160 |
Gene ID - Rat | ENSRNOG00000005606 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MED1 pAb (ATL-HPA052818) | |
Datasheet | Anti MED1 pAb (ATL-HPA052818) Datasheet (External Link) |
Vendor Page | Anti MED1 pAb (ATL-HPA052818) at Atlas Antibodies |
Documents & Links for Anti MED1 pAb (ATL-HPA052818) | |
Datasheet | Anti MED1 pAb (ATL-HPA052818) Datasheet (External Link) |
Vendor Page | Anti MED1 pAb (ATL-HPA052818) |
Citations for Anti MED1 pAb (ATL-HPA052818) – 1 Found |
Kawachi, Toshihiko; Masuda, Akio; Yamashita, Yoshihiro; Takeda, Jun-Ichi; Ohkawara, Bisei; Ito, Mikako; Ohno, Kinji. Regulated splicing of large exons is linked to phase-separation of vertebrate transcription factors. The Embo Journal. 2021;40(22):e107485. PubMed |