Anti MED1 pAb (ATL-HPA052818)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052818-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MED1
Alternative Gene Name: CRSP1, CRSP200, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018160: 100%, ENSRNOG00000005606: 100%
Entrez Gene ID: 5469
Uniprot ID: Q15648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
| Gene Sequence | MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP |
| Gene ID - Mouse | ENSMUSG00000018160 |
| Gene ID - Rat | ENSRNOG00000005606 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MED1 pAb (ATL-HPA052818) | |
| Datasheet | Anti MED1 pAb (ATL-HPA052818) Datasheet (External Link) |
| Vendor Page | Anti MED1 pAb (ATL-HPA052818) at Atlas Antibodies |
| Documents & Links for Anti MED1 pAb (ATL-HPA052818) | |
| Datasheet | Anti MED1 pAb (ATL-HPA052818) Datasheet (External Link) |
| Vendor Page | Anti MED1 pAb (ATL-HPA052818) |
| Citations for Anti MED1 pAb (ATL-HPA052818) – 1 Found |
| Kawachi, Toshihiko; Masuda, Akio; Yamashita, Yoshihiro; Takeda, Jun-Ichi; Ohkawara, Bisei; Ito, Mikako; Ohno, Kinji. Regulated splicing of large exons is linked to phase-separation of vertebrate transcription factors. The Embo Journal. 2021;40(22):e107485. PubMed |