Anti MDS2 pAb (ATL-HPA052999)

Atlas Antibodies

Catalog No.:
ATL-HPA052999-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: myelodysplastic syndrome 2 translocation associated
Gene Name: MDS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030313: 26%, ENSRNOG00000049378: 26%
Entrez Gene ID: 259283
Uniprot ID: Q8NDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLTL
Gene Sequence FIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLTL
Gene ID - Mouse ENSMUSG00000030313
Gene ID - Rat ENSRNOG00000049378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDS2 pAb (ATL-HPA052999)
Datasheet Anti MDS2 pAb (ATL-HPA052999) Datasheet (External Link)
Vendor Page Anti MDS2 pAb (ATL-HPA052999) at Atlas Antibodies

Documents & Links for Anti MDS2 pAb (ATL-HPA052999)
Datasheet Anti MDS2 pAb (ATL-HPA052999) Datasheet (External Link)
Vendor Page Anti MDS2 pAb (ATL-HPA052999)