Anti MDM4 pAb (ATL-HPA048821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048821-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MDM4
Alternative Gene Name: HDMX, MDMX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054387: 89%, ENSRNOG00000009696: 91%
Entrez Gene ID: 4194
Uniprot ID: O15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS |
| Gene Sequence | LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS |
| Gene ID - Mouse | ENSMUSG00000054387 |
| Gene ID - Rat | ENSRNOG00000009696 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MDM4 pAb (ATL-HPA048821) | |
| Datasheet | Anti MDM4 pAb (ATL-HPA048821) Datasheet (External Link) |
| Vendor Page | Anti MDM4 pAb (ATL-HPA048821) at Atlas Antibodies |
| Documents & Links for Anti MDM4 pAb (ATL-HPA048821) | |
| Datasheet | Anti MDM4 pAb (ATL-HPA048821) Datasheet (External Link) |
| Vendor Page | Anti MDM4 pAb (ATL-HPA048821) |