Anti MDM4 pAb (ATL-HPA048821)

Atlas Antibodies

Catalog No.:
ATL-HPA048821-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MDM4, p53 regulator
Gene Name: MDM4
Alternative Gene Name: HDMX, MDMX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054387: 89%, ENSRNOG00000009696: 91%
Entrez Gene ID: 4194
Uniprot ID: O15151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS
Gene Sequence LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS
Gene ID - Mouse ENSMUSG00000054387
Gene ID - Rat ENSRNOG00000009696
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDM4 pAb (ATL-HPA048821)
Datasheet Anti MDM4 pAb (ATL-HPA048821) Datasheet (External Link)
Vendor Page Anti MDM4 pAb (ATL-HPA048821) at Atlas Antibodies

Documents & Links for Anti MDM4 pAb (ATL-HPA048821)
Datasheet Anti MDM4 pAb (ATL-HPA048821) Datasheet (External Link)
Vendor Page Anti MDM4 pAb (ATL-HPA048821)