Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019714-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: malate dehydrogenase 2, NAD (mitochondrial)
Gene Name: MDH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019179: 98%, ENSRNOG00000001440: 98%
Entrez Gene ID: 4191
Uniprot ID: P40926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM
Gene Sequence VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM
Gene ID - Mouse ENSMUSG00000019179
Gene ID - Rat ENSRNOG00000001440
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation)
Datasheet Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation)
Datasheet Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation)
Citations for Anti MDH2 pAb (ATL-HPA019714 w/enhanced validation) – 4 Found
Lutter, Michael; Khan, Michael Z; Satio, Kenji; Davis, Kevin C; Kidder, Ian J; McDaniel, Latisha; Darbro, Benjamin W; Pieper, Andrew A; Cui, Huxing. The Eating-Disorder Associated HDAC4(A778T) Mutation Alters Feeding Behaviors in Female Mice. Biological Psychiatry. 2017;81(9):770-777.  PubMed
Shin, Jung-Bum; Krey, Jocelyn F; Hassan, Ahmed; Metlagel, Zoltan; Tauscher, Andrew N; Pagana, James M; Sherman, Nicholas E; Jeffery, Erin D; Spinelli, Kateri J; Zhao, Hongyu; Wilmarth, Phillip A; Choi, Dongseok; David, Larry L; Auer, Manfred; Barr-Gillespie, Peter G. Molecular architecture of the chick vestibular hair bundle. Nature Neuroscience. 2013;16(3):365-74.  PubMed
Rzem, Rim; Achouri, Younes; Marbaix, Etienne; Schakman, Olivier; Wiame, Elsa; Marie, Sandrine; Gailly, Philippe; Vincent, Marie-Françoise; Veiga-da-Cunha, Maria; Van Schaftingen, Emile. A mouse model of L-2-hydroxyglutaric aciduria, a disorder of metabolite repair. Plos One. 10(3):e0119540.  PubMed
Latonen, Leena; Afyounian, Ebrahim; Jylhä, Antti; Nättinen, Janika; Aapola, Ulla; Annala, Matti; Kivinummi, Kati K; Tammela, Teuvo T L; Beuerman, Roger W; Uusitalo, Hannu; Nykter, Matti; Visakorpi, Tapio. Integrative proteomics in prostate cancer uncovers robustness against genomic and transcriptomic aberrations during disease progression. Nature Communications. 2018;9(1):1176.  PubMed