Anti MDH1 pAb (ATL-HPA027296)

Atlas Antibodies

Catalog No.: ATL-HPA027296-25

Protein Description: malate dehydrogenase 1, NAD (soluble)
Gene Name: MDH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020321: 96%, ENSRNOG00000008103: 97%
Entrez Gene ID: 4190
Uniprot ID: P40925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
• Gene Sequence: AGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVA
• Gene ID - Mouse: ENSMUSG00000020321
• Gene ID - Rat: ENSRNOG00000008103
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MDH1 pAb (ATL-HPA027296) – 1 Found

Zhang, Boxi; Tornmalm, Johan; Widengren, Jerker; Vakifahmetoglu-Norberg, Helin; Norberg, Erik. Characterization of the Role of the Malate Dehydrogenases to Lung Tumor Cell Survival. Journal Of Cancer. 8(11):2088-2096.