Anti MDGA2 pAb (ATL-HPA003084)

Atlas Antibodies

Catalog No.:
ATL-HPA003084-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: MAM domain containing glycosylphosphatidylinositol anchor 2
Gene Name: MDGA2
Alternative Gene Name: MAMDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034912: 99%, ENSRNOG00000000618: 99%
Entrez Gene ID: 161357
Uniprot ID: Q7Z553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
Gene Sequence ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV
Gene ID - Mouse ENSMUSG00000034912
Gene ID - Rat ENSRNOG00000000618
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MDGA2 pAb (ATL-HPA003084)
Datasheet Anti MDGA2 pAb (ATL-HPA003084) Datasheet (External Link)
Vendor Page Anti MDGA2 pAb (ATL-HPA003084) at Atlas Antibodies

Documents & Links for Anti MDGA2 pAb (ATL-HPA003084)
Datasheet Anti MDGA2 pAb (ATL-HPA003084) Datasheet (External Link)
Vendor Page Anti MDGA2 pAb (ATL-HPA003084)
Citations for Anti MDGA2 pAb (ATL-HPA003084) – 2 Found
Hellquist, Anna; Zucchelli, Marco; Lindgren, Cecilia M; Saarialho-Kere, Ulpu; Järvinen, Tiina M; Koskenmies, Sari; Julkunen, Heikki; Onkamo, Päivi; Skoog, Tiina; Panelius, Jaana; Räisänen-Sokolowski, Anne; Hasan, Taina; Widen, Elisabeth; Gunnarson, Iva; Svenungsson, Elisabet; Padyukov, Leonid; Assadi, Ghazaleh; Berglind, Linda; Mäkelä, Ville-Veikko; Kivinen, Katja; Wong, Andrew; Cunningham Graham, Deborah S; Vyse, Timothy J; D'Amato, Mauro; Kere, Juha. Identification of MAMDC1 as a candidate susceptibility gene for systemic lupus erythematosus (SLE). Plos One. 2009;4(12):e8037.  PubMed
Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.  PubMed