Anti MCTP2 pAb (ATL-HPA070541)

Atlas Antibodies

Catalog No.: ATL-HPA070541-25

Protein Description: multiple C2 domains, transmembrane 2
Gene Name: MCTP2
Alternative Gene Name: FLJ11175, FLJ33303
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%
Entrez Gene ID: 55784
Uniprot ID: Q6DN12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW
• Gene Sequence: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW
• Gene ID - Mouse: ENSMUSG00000032776
• Gene ID - Rat: ENSRNOG00000009932
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.