Anti MCTP2 pAb (ATL-HPA070541)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070541-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MCTP2
Alternative Gene Name: FLJ11175, FLJ33303
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%
Entrez Gene ID: 55784
Uniprot ID: Q6DN12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW |
| Gene Sequence | RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW |
| Gene ID - Mouse | ENSMUSG00000032776 |
| Gene ID - Rat | ENSRNOG00000009932 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MCTP2 pAb (ATL-HPA070541) | |
| Datasheet | Anti MCTP2 pAb (ATL-HPA070541) Datasheet (External Link) |
| Vendor Page | Anti MCTP2 pAb (ATL-HPA070541) at Atlas Antibodies |
| Documents & Links for Anti MCTP2 pAb (ATL-HPA070541) | |
| Datasheet | Anti MCTP2 pAb (ATL-HPA070541) Datasheet (External Link) |
| Vendor Page | Anti MCTP2 pAb (ATL-HPA070541) |