Anti MCTP2 pAb (ATL-HPA070541)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070541-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MCTP2
Alternative Gene Name: FLJ11175, FLJ33303
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%
Entrez Gene ID: 55784
Uniprot ID: Q6DN12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW |
Gene Sequence | RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW |
Gene ID - Mouse | ENSMUSG00000032776 |
Gene ID - Rat | ENSRNOG00000009932 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCTP2 pAb (ATL-HPA070541) | |
Datasheet | Anti MCTP2 pAb (ATL-HPA070541) Datasheet (External Link) |
Vendor Page | Anti MCTP2 pAb (ATL-HPA070541) at Atlas Antibodies |
Documents & Links for Anti MCTP2 pAb (ATL-HPA070541) | |
Datasheet | Anti MCTP2 pAb (ATL-HPA070541) Datasheet (External Link) |
Vendor Page | Anti MCTP2 pAb (ATL-HPA070541) |