Anti MCRIP2 pAb (ATL-HPA060363)

Atlas Antibodies

Catalog No.:
ATL-HPA060363-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MAPK regulated corepressor interacting protein 2
Gene Name: MCRIP2
Alternative Gene Name: C16orf14, FAM195A, MGC15416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025732: 86%, ENSRNOG00000020029: 85%
Entrez Gene ID: 84331
Uniprot ID: Q9BUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSC
Gene Sequence EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSC
Gene ID - Mouse ENSMUSG00000025732
Gene ID - Rat ENSRNOG00000020029
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCRIP2 pAb (ATL-HPA060363)
Datasheet Anti MCRIP2 pAb (ATL-HPA060363) Datasheet (External Link)
Vendor Page Anti MCRIP2 pAb (ATL-HPA060363) at Atlas Antibodies

Documents & Links for Anti MCRIP2 pAb (ATL-HPA060363)
Datasheet Anti MCRIP2 pAb (ATL-HPA060363) Datasheet (External Link)
Vendor Page Anti MCRIP2 pAb (ATL-HPA060363)