Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062137-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mucolipin 3
Gene Name: MCOLN3
Alternative Gene Name: FLJ11006, TRP-ML3, TRPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036853: 88%, ENSRNOG00000015024: 86%
Entrez Gene ID: 55283
Uniprot ID: Q8TDD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY
Gene Sequence KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY
Gene ID - Mouse ENSMUSG00000036853
Gene ID - Rat ENSRNOG00000015024
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation)
Datasheet Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation)
Datasheet Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MCOLN3 pAb (ATL-HPA062137 w/enhanced validation)