Anti MCOLN2 pAb (ATL-HPA019114)

Atlas Antibodies

Catalog No.: ATL-HPA019114-25

Protein Description: mucolipin 2
Gene Name: MCOLN2
Alternative Gene Name: FLJ36691, TRP-ML2, TRPML2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011008: 70%, ENSRNOG00000015089: 66%
Entrez Gene ID: 255231
Uniprot ID: Q8IZK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
• Gene Sequence: YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR
• Gene ID - Mouse: ENSMUSG00000011008
• Gene ID - Rat: ENSRNOG00000015089
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.