Anti MCOLN1 pAb (ATL-HPA069495)

Atlas Antibodies

Catalog No.:
ATL-HPA069495-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mucolipin 1
Gene Name: MCOLN1
Alternative Gene Name: ML4, MLIV, MST080, MSTP080, TRPM-L1, TRPML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004567: 89%, ENSRNOG00000000975: 90%
Entrez Gene ID: 57192
Uniprot ID: Q9GZU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDC
Gene Sequence FLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDC
Gene ID - Mouse ENSMUSG00000004567
Gene ID - Rat ENSRNOG00000000975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCOLN1 pAb (ATL-HPA069495)
Datasheet Anti MCOLN1 pAb (ATL-HPA069495) Datasheet (External Link)
Vendor Page Anti MCOLN1 pAb (ATL-HPA069495) at Atlas Antibodies

Documents & Links for Anti MCOLN1 pAb (ATL-HPA069495)
Datasheet Anti MCOLN1 pAb (ATL-HPA069495) Datasheet (External Link)
Vendor Page Anti MCOLN1 pAb (ATL-HPA069495)