Anti MCM8 pAb (ATL-HPA066433)
Atlas Antibodies
- SKU:
- ATL-HPA066433-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MCM8
Alternative Gene Name: C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027353: 88%, ENSRNOG00000021272: 90%
Entrez Gene ID: 84515
Uniprot ID: Q9UJA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA |
Gene Sequence | GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA |
Gene ID - Mouse | ENSMUSG00000027353 |
Gene ID - Rat | ENSRNOG00000021272 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MCM8 pAb (ATL-HPA066433) | |
Datasheet | Anti MCM8 pAb (ATL-HPA066433) Datasheet (External Link) |
Vendor Page | Anti MCM8 pAb (ATL-HPA066433) at Atlas Antibodies |
Documents & Links for Anti MCM8 pAb (ATL-HPA066433) | |
Datasheet | Anti MCM8 pAb (ATL-HPA066433) Datasheet (External Link) |
Vendor Page | Anti MCM8 pAb (ATL-HPA066433) |