Anti MCM8 pAb (ATL-HPA066433)

Atlas Antibodies

Catalog No.:
ATL-HPA066433-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: minichromosome maintenance 8 homologous recombination repair factor
Gene Name: MCM8
Alternative Gene Name: C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027353: 88%, ENSRNOG00000021272: 90%
Entrez Gene ID: 84515
Uniprot ID: Q9UJA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA
Gene Sequence GDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELVKA
Gene ID - Mouse ENSMUSG00000027353
Gene ID - Rat ENSRNOG00000021272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCM8 pAb (ATL-HPA066433)
Datasheet Anti MCM8 pAb (ATL-HPA066433) Datasheet (External Link)
Vendor Page Anti MCM8 pAb (ATL-HPA066433) at Atlas Antibodies

Documents & Links for Anti MCM8 pAb (ATL-HPA066433)
Datasheet Anti MCM8 pAb (ATL-HPA066433) Datasheet (External Link)
Vendor Page Anti MCM8 pAb (ATL-HPA066433)