Anti MCM10 pAb (ATL-HPA071952)

Atlas Antibodies

Catalog No.:
ATL-HPA071952-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: minichromosome maintenance 10 replication initiation factor
Gene Name: MCM10
Alternative Gene Name: CNA43, DNA43, PRO2249
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026669: 84%, ENSRNOG00000017981: 88%
Entrez Gene ID: 55388
Uniprot ID: Q7L590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
Gene Sequence REKLEEIDWVTFGVILKKVTPQSVNSGKTFSIWKLNDLRDLTQCVSLFLFGEVHKALWKTEQGTVVGILNANPMK
Gene ID - Mouse ENSMUSG00000026669
Gene ID - Rat ENSRNOG00000017981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MCM10 pAb (ATL-HPA071952)
Datasheet Anti MCM10 pAb (ATL-HPA071952) Datasheet (External Link)
Vendor Page Anti MCM10 pAb (ATL-HPA071952) at Atlas Antibodies

Documents & Links for Anti MCM10 pAb (ATL-HPA071952)
Datasheet Anti MCM10 pAb (ATL-HPA071952) Datasheet (External Link)
Vendor Page Anti MCM10 pAb (ATL-HPA071952)