Anti MCL1 pAb (ATL-HPA008455)

Atlas Antibodies

Catalog No.: ATL-HPA008455-25

Protein Description: myeloid cell leukemia 1
Gene Name: MCL1
Alternative Gene Name: BCL2L3, Mcl-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038612: 77%, ENSRNOG00000010237: 26%
Entrez Gene ID: 4170
Uniprot ID: Q07820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
• Gene Sequence: DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
• Gene ID - Mouse: ENSMUSG00000038612
• Gene ID - Rat: ENSRNOG00000010237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MCL1 pAb (ATL-HPA008455) – 8 Found

Márquez-Jurado, Silvia; Díaz-Colunga, Juan; das Neves, Ricardo Pires; Martinez-Lorente, Antonio; Almazán, Fernando; Guantes, Raúl; Iborra, Francisco J. Mitochondrial levels determine variability in cell death by modulating apoptotic gene expression. Nature Communications. 2018;9(1):389. 

Roders, Nathalie; Herr, Florence; Ambroise, Gorbatchev; Thaunat, Olivier; Portier, Alain; Vazquez, Aimé; Durrbach, Antoine. SYK Inhibition Induces Apoptosis in Germinal Center-Like B Cells by Modulating the Antiapoptotic Protein Myeloid Cell Leukemia-1, Affecting B-Cell Activation and Antibody Production. Frontiers In Immunology. 9( 29740433):787. 

Ariës, Ingrid M; Hansen, Bo R; Koch, Troels; van den Dungen, Rosanna; Evans, William E; Pieters, Rob; den Boer, Monique L. The synergism of MCL1 and glycolysis on pediatric acute lymphoblastic leukemia cell survival and prednisolone resistance. Haematologica. 2013;98(12):1905-11. 

Némati, Fariba; de Montrion, Catherine; Lang, Guillaume; Kraus-Berthier, Laurence; Carita, Guillaume; Sastre-Garau, Xavier; Berniard, Aurélie; Vallerand, David; Geneste, Olivier; de Plater, Ludmilla; Pierré, Alain; Lockhart, Brian; Desjardins, Laurence; Piperno-Neumann, Sophie; Depil, Stéphane; Decaudin, Didier. Targeting Bcl-2/Bcl-XL induces antitumor activity in uveal melanoma patient-derived xenografts. Plos One. 9(1):e80836. 

Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44. 

Li, Yunlei; Buijs-Gladdines, Jessica G C A M; Canté-Barrett, Kirsten; Stubbs, Andrew P; Vroegindeweij, Eric M; Smits, Willem K; van Marion, Ronald; Dinjens, Winand N M; Horstmann, Martin; Kuiper, Roland P; Buijsman, Rogier C; Zaman, Guido J R; van der Spek, Peter J; Pieters, Rob; Meijerink, Jules P P. IL-7 Receptor Mutations and Steroid Resistance in Pediatric T cell Acute Lymphoblastic Leukemia: A Genome Sequencing Study. Plos Medicine. 2016;13(12):e1002200. 

Wu, Xiaowei; Luo, Qingyu; Zhao, Pengfei; Chang, Wan; Wang, Yating; Shu, Tong; Ding, Fang; Li, Bin; Liu, Zhihua. JOSD1 inhibits mitochondrial apoptotic signalling to drive acquired chemoresistance in gynaecological cancer by stabilizing MCL1. Cell Death And Differentiation. 2020;27(1):55-70. 

Carter, Rachel J; Milani, Mateus; Butterworth, Michael; Alotibi, Ahoud; Harper, Nicholas; Yedida, Govindaraju; Greaves, Georgia; Al-Zebeeby, Aoula; Jorgensen, Andrea L; Schache, Andrew G; Risk, Janet M; Shaw, Richard J; Jones, Terry M; Sacco, Joseph J; Hurlstone, Adam; Cohen, Gerald M; Varadarajan, Shankar. Exploring the potential of BH3 mimetic therapy in squamous cell carcinoma of the head and neck. Cell Death & Disease. 2019;10(12):912.