Anti MBP pAb (ATL-HPA064368)

Atlas Antibodies

SKU:
ATL-HPA064368-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to plasma membrane.
  • Western blot analysis in human cerebral cortex tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: myelin basic protein
Gene Name: MBP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041607: 76%, ENSRNOG00000016516: 77%
Entrez Gene ID: 4155
Uniprot ID: P02686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP
Gene Sequence ASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAP
Gene ID - Mouse ENSMUSG00000041607
Gene ID - Rat ENSRNOG00000016516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MBP pAb (ATL-HPA064368)
Datasheet Anti MBP pAb (ATL-HPA064368) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA064368) at Atlas Antibodies

Documents & Links for Anti MBP pAb (ATL-HPA064368)
Datasheet Anti MBP pAb (ATL-HPA064368) Datasheet (External Link)
Vendor Page Anti MBP pAb (ATL-HPA064368)