Anti MBOAT4 pAb (ATL-HPA044509)

Atlas Antibodies

Catalog No.: ATL-HPA044509-25

Protein Description: membrane bound O-acyltransferase domain containing 4
Gene Name: MBOAT4
Alternative Gene Name: FKSG89, GOAT, OACT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071113: 81%, ENSRNOG00000030102: 79%
Entrez Gene ID: 619373
Uniprot ID: Q96T53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHS
• Gene Sequence: LDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHS
• Gene ID - Mouse: ENSMUSG00000071113
• Gene ID - Rat: ENSRNOG00000030102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.