Anti MBNL2 pAb (ATL-HPA062685)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062685-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MBNL2
Alternative Gene Name: MBLL, MBLL39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022139: 96%, ENSRNOG00000010737: 96%
Entrez Gene ID: 10150
Uniprot ID: Q5VZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV |
Gene Sequence | AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV |
Gene ID - Mouse | ENSMUSG00000022139 |
Gene ID - Rat | ENSRNOG00000010737 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MBNL2 pAb (ATL-HPA062685) | |
Datasheet | Anti MBNL2 pAb (ATL-HPA062685) Datasheet (External Link) |
Vendor Page | Anti MBNL2 pAb (ATL-HPA062685) at Atlas Antibodies |
Documents & Links for Anti MBNL2 pAb (ATL-HPA062685) | |
Datasheet | Anti MBNL2 pAb (ATL-HPA062685) Datasheet (External Link) |
Vendor Page | Anti MBNL2 pAb (ATL-HPA062685) |