Anti MBLAC2 pAb (ATL-HPA060264)

Atlas Antibodies

Catalog No.:
ATL-HPA060264-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: metallo-beta-lactamase domain containing 2
Gene Name: MBLAC2
Alternative Gene Name: DKFZp686P15118, MGC46734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051098: 96%, ENSRNOG00000016252: 97%
Entrez Gene ID: 153364
Uniprot ID: Q68D91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDA
Gene Sequence MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDA
Gene ID - Mouse ENSMUSG00000051098
Gene ID - Rat ENSRNOG00000016252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MBLAC2 pAb (ATL-HPA060264)
Datasheet Anti MBLAC2 pAb (ATL-HPA060264) Datasheet (External Link)
Vendor Page Anti MBLAC2 pAb (ATL-HPA060264) at Atlas Antibodies

Documents & Links for Anti MBLAC2 pAb (ATL-HPA060264)
Datasheet Anti MBLAC2 pAb (ATL-HPA060264) Datasheet (External Link)
Vendor Page Anti MBLAC2 pAb (ATL-HPA060264)