Anti MBLAC2 pAb (ATL-HPA060264)

Atlas Antibodies

Catalog No.: ATL-HPA060264-25

Protein Description: metallo-beta-lactamase domain containing 2
Gene Name: MBLAC2
Alternative Gene Name: DKFZp686P15118, MGC46734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051098: 96%, ENSRNOG00000016252: 97%
Entrez Gene ID: 153364
Uniprot ID: Q68D91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDA
• Gene Sequence: MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKEDA
• Gene ID - Mouse: ENSMUSG00000051098
• Gene ID - Rat: ENSRNOG00000016252
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.