Anti MBLAC1 pAb (ATL-HPA071574)

Atlas Antibodies

SKU:
ATL-HPA071574-25
  • Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: metallo-beta-lactamase domain containing 1
Gene Name: MBLAC1
Alternative Gene Name: MGC49416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049285: 85%, ENSRNOG00000001357: 85%
Entrez Gene ID: 255374
Uniprot ID: A4D2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE
Gene Sequence HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE
Gene ID - Mouse ENSMUSG00000049285
Gene ID - Rat ENSRNOG00000001357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574)
Datasheet Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link)
Vendor Page Anti MBLAC1 pAb (ATL-HPA071574) at Atlas Antibodies

Documents & Links for Anti MBLAC1 pAb (ATL-HPA071574)
Datasheet Anti MBLAC1 pAb (ATL-HPA071574) Datasheet (External Link)
Vendor Page Anti MBLAC1 pAb (ATL-HPA071574)