Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002027-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: MBL2
Alternative Gene Name: COLEC1, MBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024863: 56%, ENSRNOG00000050305: 54%
Entrez Gene ID: 4153
Uniprot ID: P11226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH |
| Gene Sequence | DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH |
| Gene ID - Mouse | ENSMUSG00000024863 |
| Gene ID - Rat | ENSRNOG00000050305 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) | |
| Datasheet | Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) | |
| Datasheet | Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) |
| Citations for Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) – 4 Found |
| Chua, Jamie S; Baelde, Hans J; Zandbergen, Malu; Wilhelmus, Suzanne; van Es, Leendert A; de Fijter, Johan W; Bruijn, Jan A; Bajema, Ingeborg M; Cohen, Danielle. Complement Factor C4d Is a Common Denominator in Thrombotic Microangiopathy. Journal Of The American Society Of Nephrology : Jasn. 2015;26(9):2239-47. PubMed |
| Matthijsen, Robert A; de Winther, Menno P J; Kuipers, Dian; van der Made, Ingeborg; Weber, Christian; Herias, M Veronica; Gijbels, Marion J J; Buurman, Wim A. Macrophage-specific expression of mannose-binding lectin controls atherosclerosis in low-density lipoprotein receptor-deficient mice. Circulation. 2009;119(16):2188-95. PubMed |
| Singh, Kumud K; Nathamu, Satyanarayana; Adame, Anthony; Alire, Tara U; Dumaop, Wilmar; Gouaux, Ben; Moore, David J; Masliah, Eliezer. Expression of mannose binding lectin in HIV-1-infected brain: implications for HIV-related neuronal damage and neuroAIDS. Neurobehavioral Hiv Medicine. 2011;3( 21852898):41-52. PubMed |
| Belmonte, Beatrice; Mangogna, Alessandro; Gulino, Alessandro; Cancila, Valeria; Morello, Gaia; Agostinis, Chiara; Bulla, Roberta; Ricci, Giuseppe; Fraggetta, Filippo; Botto, Marina; Garred, Peter; Tedesco, Francesco. Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic Placentae. Frontiers In Immunology. 13( 35711467):882298. PubMed |