Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002027-25

Protein Description: mannose-binding lectin (protein C) 2, soluble
Gene Name: MBL2
Alternative Gene Name: COLEC1, MBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024863: 56%, ENSRNOG00000050305: 54%
Entrez Gene ID: 4153
Uniprot ID: P11226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
• Gene Sequence: DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
• Gene ID - Mouse: ENSMUSG00000024863
• Gene ID - Rat: ENSRNOG00000050305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MBL2 pAb (ATL-HPA002027 w/enhanced validation) – 4 Found

Chua, Jamie S; Baelde, Hans J; Zandbergen, Malu; Wilhelmus, Suzanne; van Es, Leendert A; de Fijter, Johan W; Bruijn, Jan A; Bajema, Ingeborg M; Cohen, Danielle. Complement Factor C4d Is a Common Denominator in Thrombotic Microangiopathy. Journal Of The American Society Of Nephrology : Jasn. 2015;26(9):2239-47. 

Matthijsen, Robert A; de Winther, Menno P J; Kuipers, Dian; van der Made, Ingeborg; Weber, Christian; Herias, M Veronica; Gijbels, Marion J J; Buurman, Wim A. Macrophage-specific expression of mannose-binding lectin controls atherosclerosis in low-density lipoprotein receptor-deficient mice. Circulation. 2009;119(16):2188-95. 

Singh, Kumud K; Nathamu, Satyanarayana; Adame, Anthony; Alire, Tara U; Dumaop, Wilmar; Gouaux, Ben; Moore, David J; Masliah, Eliezer. Expression of mannose binding lectin in HIV-1-infected brain: implications for HIV-related neuronal damage and neuroAIDS. Neurobehavioral Hiv Medicine. 2011;3( 21852898):41-52. 

Belmonte, Beatrice; Mangogna, Alessandro; Gulino, Alessandro; Cancila, Valeria; Morello, Gaia; Agostinis, Chiara; Bulla, Roberta; Ricci, Giuseppe; Fraggetta, Filippo; Botto, Marina; Garred, Peter; Tedesco, Francesco. Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic Placentae. Frontiers In Immunology. 13( 35711467):882298.