Anti MBD5 pAb (ATL-HPA035964)

Atlas Antibodies

Catalog No.: ATL-HPA035964-25

Protein Description: methyl-CpG binding domain protein 5
Gene Name: MBD5
Alternative Gene Name: FLJ11113, KIAA1461
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036792: 97%, ENSRNOG00000027596: 89%
Entrez Gene ID: 55777
Uniprot ID: Q9P267
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
• Gene Sequence: PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
• Gene ID - Mouse: ENSMUSG00000036792
• Gene ID - Rat: ENSRNOG00000027596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.