Anti MBD1 pAb (ATL-HPA068850)

Atlas Antibodies

SKU: ATL-HPA068850-25

• 
• 

Protein Description: methyl-CpG binding domain protein 1
Gene Name: MBD1
Alternative Gene Name: CXXC3, PCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024561: 68%, ENSRNOG00000024104: 66%
Entrez Gene ID: 4152
Uniprot ID: Q9UIS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK
• Gene Sequence: PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK
• Gene ID - Mouse: ENSMUSG00000024561
• Gene ID - Rat: ENSRNOG00000024104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.