Anti MAZ pAb (ATL-HPA059495)
Atlas Antibodies
- SKU:
- ATL-HPA059495-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAZ
Alternative Gene Name: Pur-1, ZF87, Zif87, ZNF801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030678: 98%, ENSRNOG00000055082: 98%
Entrez Gene ID: 4150
Uniprot ID: P56270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA |
Gene Sequence | PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA |
Gene ID - Mouse | ENSMUSG00000030678 |
Gene ID - Rat | ENSRNOG00000055082 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAZ pAb (ATL-HPA059495) | |
Datasheet | Anti MAZ pAb (ATL-HPA059495) Datasheet (External Link) |
Vendor Page | Anti MAZ pAb (ATL-HPA059495) at Atlas Antibodies |
Documents & Links for Anti MAZ pAb (ATL-HPA059495) | |
Datasheet | Anti MAZ pAb (ATL-HPA059495) Datasheet (External Link) |
Vendor Page | Anti MAZ pAb (ATL-HPA059495) |