Anti MAZ pAb (ATL-HPA059495)

Atlas Antibodies

SKU:
ATL-HPA059495-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MYC-associated zinc finger protein (purine-binding transcription factor)
Gene Name: MAZ
Alternative Gene Name: Pur-1, ZF87, Zif87, ZNF801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030678: 98%, ENSRNOG00000055082: 98%
Entrez Gene ID: 4150
Uniprot ID: P56270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
Gene Sequence PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
Gene ID - Mouse ENSMUSG00000030678
Gene ID - Rat ENSRNOG00000055082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAZ pAb (ATL-HPA059495)
Datasheet Anti MAZ pAb (ATL-HPA059495) Datasheet (External Link)
Vendor Page Anti MAZ pAb (ATL-HPA059495) at Atlas Antibodies

Documents & Links for Anti MAZ pAb (ATL-HPA059495)
Datasheet Anti MAZ pAb (ATL-HPA059495) Datasheet (External Link)
Vendor Page Anti MAZ pAb (ATL-HPA059495)