Anti MAZ pAb (ATL-HPA059495)

Atlas Antibodies

Catalog No.: ATL-HPA059495-25

Protein Description: MYC-associated zinc finger protein (purine-binding transcription factor)
Gene Name: MAZ
Alternative Gene Name: Pur-1, ZF87, Zif87, ZNF801
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030678: 98%, ENSRNOG00000055082: 98%
Entrez Gene ID: 4150
Uniprot ID: P56270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
• Gene Sequence: PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA
• Gene ID - Mouse: ENSMUSG00000030678
• Gene ID - Rat: ENSRNOG00000055082
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.