Anti MATR3 pAb (ATL-HPA036564)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036564-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: MATR3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037236: 100%, ENSRNOG00000019875: 100%
Entrez Gene ID: 9782
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKF |
| Gene Sequence | VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKF |
| Gene ID - Mouse | ENSMUSG00000037236 |
| Gene ID - Rat | ENSRNOG00000019875 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MATR3 pAb (ATL-HPA036564) | |
| Datasheet | Anti MATR3 pAb (ATL-HPA036564) Datasheet (External Link) |
| Vendor Page | Anti MATR3 pAb (ATL-HPA036564) at Atlas Antibodies |
| Documents & Links for Anti MATR3 pAb (ATL-HPA036564) | |
| Datasheet | Anti MATR3 pAb (ATL-HPA036564) Datasheet (External Link) |
| Vendor Page | Anti MATR3 pAb (ATL-HPA036564) |
| Citations for Anti MATR3 pAb (ATL-HPA036564) – 1 Found |
| Johnson, Janel O; Pioro, Erik P; Boehringer, Ashley; Chia, Ruth; Feit, Howard; Renton, Alan E; Pliner, Hannah A; Abramzon, Yevgeniya; Marangi, Giuseppe; Winborn, Brett J; Gibbs, J Raphael; Nalls, Michael A; Morgan, Sarah; Shoai, Maryam; Hardy, John; Pittman, Alan; Orrell, Richard W; Malaspina, Andrea; Sidle, Katie C; Fratta, Pietro; Harms, Matthew B; Baloh, Robert H; Pestronk, Alan; Weihl, Conrad C; Rogaeva, Ekaterina; Zinman, Lorne; Drory, Vivian E; Borghero, Giuseppe; Mora, Gabriele; Calvo, Andrea; Rothstein, Jeffrey D; Drepper, Carsten; Sendtner, Michael; Singleton, Andrew B; Taylor, J Paul; Cookson, Mark R; Restagno, Gabriella; Sabatelli, Mario; Bowser, Robert; Chiò, Adriano; Traynor, Bryan J. Mutations in the Matrin 3 gene cause familial amyotrophic lateral sclerosis. Nature Neuroscience. 2014;17(5):664-666. PubMed |