Anti MATK pAb (ATL-HPA066547)

Atlas Antibodies

SKU: ATL-HPA066547-100

• 
• 

Protein Description: megakaryocyte-associated tyrosine kinase
Gene Name: MATK
Alternative Gene Name: CHK, CTK, DKFZp434N1212, HHYLTK, HYL, HYLTK, Lsk, MGC1708, MGC2101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004933: 90%, ENSRNOG00000020431: 90%
Entrez Gene ID: 4145
Uniprot ID: P42679
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
• Gene Sequence: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC
• Gene ID - Mouse: ENSMUSG00000004933
• Gene ID - Rat: ENSRNOG00000020431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.