Anti MASTL pAb (ATL-HPA054273)

Atlas Antibodies

Catalog No.:
ATL-HPA054273-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: microtubule associated serine/threonine kinase-like
Gene Name: MASTL
Alternative Gene Name: FLJ14813, Gwl, THC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026779: 70%, ENSRNOG00000054474: 68%
Entrez Gene ID: 84930
Uniprot ID: Q96GX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG
Gene Sequence EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG
Gene ID - Mouse ENSMUSG00000026779
Gene ID - Rat ENSRNOG00000054474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MASTL pAb (ATL-HPA054273)
Datasheet Anti MASTL pAb (ATL-HPA054273) Datasheet (External Link)
Vendor Page Anti MASTL pAb (ATL-HPA054273) at Atlas Antibodies

Documents & Links for Anti MASTL pAb (ATL-HPA054273)
Datasheet Anti MASTL pAb (ATL-HPA054273) Datasheet (External Link)
Vendor Page Anti MASTL pAb (ATL-HPA054273)
Citations for Anti MASTL pAb (ATL-HPA054273) – 1 Found
Rata, Scott; Suarez Peredo Rodriguez, Maria F; Joseph, Stephy; Peter, Nisha; Echegaray Iturra, Fabio; Yang, Fengwei; Madzvamuse, Anotida; Ruppert, Jan G; Samejima, Kumiko; Platani, Melpomeni; Alvarez-Fernandez, Monica; Malumbres, Marcos; Earnshaw, William C; Novak, Bela; Hochegger, Helfrid. Two Interlinked Bistable Switches Govern Mitotic Control in Mammalian Cells. Current Biology : Cb. 2018;28(23):3824-3832.e6.  PubMed