Anti MASTL pAb (ATL-HPA054273)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054273-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MASTL
Alternative Gene Name: FLJ14813, Gwl, THC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026779: 70%, ENSRNOG00000054474: 68%
Entrez Gene ID: 84930
Uniprot ID: Q96GX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG |
Gene Sequence | EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG |
Gene ID - Mouse | ENSMUSG00000026779 |
Gene ID - Rat | ENSRNOG00000054474 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MASTL pAb (ATL-HPA054273) | |
Datasheet | Anti MASTL pAb (ATL-HPA054273) Datasheet (External Link) |
Vendor Page | Anti MASTL pAb (ATL-HPA054273) at Atlas Antibodies |
Documents & Links for Anti MASTL pAb (ATL-HPA054273) | |
Datasheet | Anti MASTL pAb (ATL-HPA054273) Datasheet (External Link) |
Vendor Page | Anti MASTL pAb (ATL-HPA054273) |
Citations for Anti MASTL pAb (ATL-HPA054273) – 1 Found |
Rata, Scott; Suarez Peredo Rodriguez, Maria F; Joseph, Stephy; Peter, Nisha; Echegaray Iturra, Fabio; Yang, Fengwei; Madzvamuse, Anotida; Ruppert, Jan G; Samejima, Kumiko; Platani, Melpomeni; Alvarez-Fernandez, Monica; Malumbres, Marcos; Earnshaw, William C; Novak, Bela; Hochegger, Helfrid. Two Interlinked Bistable Switches Govern Mitotic Control in Mammalian Cells. Current Biology : Cb. 2018;28(23):3824-3832.e6. PubMed |