Anti MASTL pAb (ATL-HPA027175 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027175-25

Protein Description: microtubule associated serine/threonine kinase-like
Gene Name: MASTL
Alternative Gene Name: FLJ14813, THC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026779: 62%, ENSRNOG00000054474: 64%
Entrez Gene ID: 84930
Uniprot ID: Q96GX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQNDCANKEN
• Gene Sequence: TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQNDCANKEN
• Gene ID - Mouse: ENSMUSG00000026779
• Gene ID - Rat: ENSRNOG00000054474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MASTL pAb (ATL-HPA027175 w/enhanced validation) – 3 Found

Närvä, Elisa; Taskinen, Maria E; Lilla, Sergio; Isomursu, Aleksi; Pietilä, Mika; Weltner, Jere; Isola, Jorma; Sihto, Harri; Joensuu, Heikki; Zanivan, Sara; Norman, Jim; Ivaska, Johanna. MASTL is enriched in cancerous and pluripotent stem cells and influences OCT1/OCT4 levels. Iscience. 2022;25(6):104459. 

Hégarat, Nadia; Vesely, Clare; Vinod, P K; Ocasio, Cory; Peter, Nisha; Gannon, Julian; Oliver, Antony W; Novák, Béla; Hochegger, Helfrid. PP2A/B55 and Fcp1 regulate Greatwall and Ensa dephosphorylation during mitotic exit. Plos Genetics. 2014;10(1):e1004004. 

Taskinen, Maria Emilia; Närvä, Elisa; Conway, James R W; Hinojosa, Laura Soto; Lilla, Sergio; Mai, Anja; De Franceschi, Nicola; Elo, Laura L; Grosse, Robert; Zanivan, Sara; Norman, Jim C; Ivaska, Johanna. MASTL promotes cell contractility and motility through kinase-independent signaling. The Journal Of Cell Biology. 2020;219(6)