Anti MAST2 pAb (ATL-HPA040155)

Atlas Antibodies

Catalog No.: ATL-HPA040155-25

Protein Description: microtubule associated serine/threonine kinase 2
Gene Name: MAST2
Alternative Gene Name: KIAA0807, MAST205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003810: 94%, ENSRNOG00000058476: 94%
Entrez Gene ID: 23139
Uniprot ID: Q6P0Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
• Gene Sequence: LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
• Gene ID - Mouse: ENSMUSG00000003810
• Gene ID - Rat: ENSRNOG00000058476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAST2 pAb (ATL-HPA040155) – 1 Found

Eißmann, Moritz; Schwamb, Bettina; Melzer, Inga Maria; Moser, Julia; Siele, Dagmar; Köhl, Ulrike; Rieker, Ralf Joachim; Wachter, David Lukas; Agaimy, Abbas; Herpel, Esther; Baumgarten, Peter; Mittelbronn, Michel; Rakel, Stefanie; Kögel, Donat; Böhm, Stefanie; Gutschner, Tony; Diederichs, Sven; Zörnig, Martin. A functional yeast survival screen of tumor-derived cDNA libraries designed to identify anti-apoptotic mammalian oncogenes. Plos One. 8(5):e64873.