Anti MAST2 pAb (ATL-HPA039722)

Atlas Antibodies

Catalog No.: ATL-HPA039722-25

Protein Description: microtubule associated serine/threonine kinase 2
Gene Name: MAST2
Alternative Gene Name: KIAA0807, MAST205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003810: 46%, ENSRNOG00000058476: 46%
Entrez Gene ID: 23139
Uniprot ID: Q6P0Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG
• Gene Sequence: GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG
• Gene ID - Mouse: ENSMUSG00000003810
• Gene ID - Rat: ENSRNOG00000058476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.