Anti MAST2 pAb (ATL-HPA039722)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039722-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MAST2
Alternative Gene Name: KIAA0807, MAST205
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003810: 46%, ENSRNOG00000058476: 46%
Entrez Gene ID: 23139
Uniprot ID: Q6P0Q8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG |
| Gene Sequence | GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG |
| Gene ID - Mouse | ENSMUSG00000003810 |
| Gene ID - Rat | ENSRNOG00000058476 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAST2 pAb (ATL-HPA039722) | |
| Datasheet | Anti MAST2 pAb (ATL-HPA039722) Datasheet (External Link) |
| Vendor Page | Anti MAST2 pAb (ATL-HPA039722) at Atlas Antibodies |
| Documents & Links for Anti MAST2 pAb (ATL-HPA039722) | |
| Datasheet | Anti MAST2 pAb (ATL-HPA039722) Datasheet (External Link) |
| Vendor Page | Anti MAST2 pAb (ATL-HPA039722) |