Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA073106-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-MAST1 antibody. Corresponding MAST1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: microtubule associated serine/threonine kinase 1
Gene Name: MAST1
Alternative Gene Name: KIAA0973, SAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053693: 98%, ENSRNOG00000003469: 98%
Entrez Gene ID: 22983
Uniprot ID: Q9Y2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE
Gene Sequence LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE
Gene ID - Mouse ENSMUSG00000053693
Gene ID - Rat ENSRNOG00000003469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation)
Datasheet Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation)
Datasheet Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MAST1 pAb (ATL-HPA073106 w/enhanced validation)