Anti MASP1 pAb (ATL-HPA001617)

Atlas Antibodies

Catalog No.: ATL-HPA001617-25

Protein Description: mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
Gene Name: MASP1
Alternative Gene Name: CRARF, MASP, PRSS5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022887: 88%, ENSRNOG00000001827: 88%
Entrez Gene ID: 5648
Uniprot ID: P48740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
• Gene Sequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
• Gene ID - Mouse: ENSMUSG00000022887
• Gene ID - Rat: ENSRNOG00000001827
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MASP1 pAb (ATL-HPA001617) – 2 Found

Belmonte, Beatrice; Mangogna, Alessandro; Gulino, Alessandro; Cancila, Valeria; Morello, Gaia; Agostinis, Chiara; Bulla, Roberta; Ricci, Giuseppe; Fraggetta, Filippo; Botto, Marina; Garred, Peter; Tedesco, Francesco. Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic Placentae. Frontiers In Immunology. 13( 35711467):882298. 

Golomingi, Murielle; Kohler, Jessie; Jenny, Lorenz; Hardy, Elaissa T; Dobó, József; Gál, Péter; Pál, Gábor; Kiss, Bence; Lam, Wilbur A; Schroeder, Verena. Complement lectin pathway components MBL and MASP-1 promote haemostasis upon vessel injury in a microvascular bleeding model. Frontiers In Immunology. 13( 36032172):948190.