Anti MAS1 pAb (ATL-HPA079325)

Atlas Antibodies

Catalog No.:
ATL-HPA079325-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MAS1 proto-oncogene, G protein-coupled receptor
Gene Name: MAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068037: 85%, ENSRNOG00000014971: 85%
Entrez Gene ID: 4142
Uniprot ID: P04201
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV
Gene Sequence SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV
Gene ID - Mouse ENSMUSG00000068037
Gene ID - Rat ENSRNOG00000014971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAS1 pAb (ATL-HPA079325)
Datasheet Anti MAS1 pAb (ATL-HPA079325) Datasheet (External Link)
Vendor Page Anti MAS1 pAb (ATL-HPA079325) at Atlas Antibodies

Documents & Links for Anti MAS1 pAb (ATL-HPA079325)
Datasheet Anti MAS1 pAb (ATL-HPA079325) Datasheet (External Link)
Vendor Page Anti MAS1 pAb (ATL-HPA079325)